[CAS NO. 161748-29-4] GLP-1(9-36)amide
PRODUCTS SPECIFICATIONS [161748-29-4]
DESCRIPTION [161748-29-4]
Overview
| MDL | - |
|---|---|
| Molecular Weight | 3089.41 |
| Molecular Formula | C140H214N36O43 |
| SMILES | [EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2] |
Summary
GLP-1(9-36)amide is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide acts as an antagonist to the human pancreatic GLP-1 receptor [1] [2] .
In Vitro
GLP-1(9-36)amide potently inhibits hepatic glucose production (HGP) and is a weak insulinotropic agent [2] .
MCE has not independently confirmed the accuracy of these methods. They are for reference only.
Appearance
Solid
Shipping
Room temperature in continental US; may vary elsewhere.
Storage
Sealed storage, away from moisture
| Powder | -80°C | 2 years |
|---|---|---|
| -20°C | 1 year |
* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
H 2 O : ≥ 25 mg/mL ( 8.09 mM )
* "≥" means soluble, but saturation unknown.
Stock Solutions
| Concentration Solvent Mass | 1 mg | 5 mg | 10 mg |
|---|
| 1 mM | 0.3237 mL | 1.6184 mL | 3.2369 mL |
| 5 mM | 0.0647 mL | 0.3237 mL | 0.6474 mL |
| 10 mM | --- | --- | --- |
References
- [1] Knudsen LB, et al. Glucagon-like peptide-1-(9-36) amide is a major metabolite of glucagon-like peptide-1-(7-36) amide after in vivo administration to dogs, and it acts as an antagonist on the pancreatic receptor. Eur J Pharmacol. 1996;318(2-3):429-435.
- [2] Elahi D, et al. GLP-1 (9-36) amide, cleavage product of GLP-1 (7-36) amide, is a glucoregulatory peptide. Obesity (Silver Spring). 2008;16(7):1501-1509.