Arctom: Online Shopping for Building Blocks & Research Chemicals. iGluR

Categories

Organometallic Reagents

- Organosilicon

- Other Organometallic Reagents

Organic Building Blocks

- Acid Anhydrides

- Acyl Chlorides

- Aliphatic Chain Hydrocarbons

- Aliphatic Cyclic Hydrocarbons

- Amino Acids and Derivatives

- Benzene Compounds

- Benzyl bromides

- Benzyl Chlorides

- Bis(trifluoromethylsulfonyl)imines

- Carboxylic Acid Salts

- Carboxylic Acids

- Difluoromethyls

- Fluorinated Building Blocks

- Hydroxylamines

- Isocyanates and Isothiocyanates

- N-Substituted Succinimides

- Nitrates and Nitrites

- Other Function Groups

- Other Organic Building Blocks

- PEG compounds

- Polycyclic aromatic hydrocarbons

- Protective Groups

- Saturated aliphatic fused ring

- Silicon compounds

- Sulfonic Acids

- Sulfonyl Chlorides

- Sulfonyl Hydrazides

- Trifluoromethanesulfonate

- Trifluoromethyls

- Selenium compounds

Catalysis Chemistry

- Achiral Crown Ligands

- C-H Activation

- Carbon-Donor Ligands

- Chiral Carbon Ligands

- Chiral Crown Ligands

- Chiral Olefin Ligands

- Cross-Coupling

- Cross-Coupling Using Transition Metal Catalysts

- DACH or Trost Ligands

- Diketone Ligands

- Hydrogenation

- Main-Group Elements

- Metal Catalysts

- Nitrogen-Donor Ligands

- Non-Precious Metal Catalysts

- Olefin Ligands

- Olefin Metathesis

- Organocatalysts

- Other Ligands

- OX or FeOX Ligands

- Phosphorous Compounds

- Phosphorus Ligand

- Photocatalysts

- Pincer Ligands

- Rare-Earth Elements

- Transition Elements

Asymmetric Synthesis

- Chiral Building Blocks

- Chiral Catalysts, Chiral Ligands and Chiral Reagents

- Chiral Resolution Reagents

Synthetic Reagents

- Acids and Bases

- C-C Bond Formation

- C-X Bond Formation (Halogen)

- C-X Bond Formation (Non-Halogen)

- Chelation and Complexation Compounds

- Condensation Agents

- Dehydrating Reagents

- Fluorination Reagent

- Fluorination Reagents

- Halogenation Reagents

- Hypervalent Iodine Compounds

- Inorganic Salts

- Other Synthetic Reagents

- Oxidizing Agents

- Phase Transfer Catalysts

- Polymer-Supported Reagents

- Protection, Deprotection and Derivatization

- Radical Chemistry

- Wittig Reagents

Chemical Biology

- Conjugation Chemistry

- Linkers and Crosslinkers

- Nucleic Acid Chemistry

- Peptide Chemistry

- Photolabile Protecting Group

Specialty Synthesis

- Enzyme-Mediated Synthesis

- Fluorous Synthesis

- Ionic Liquids

- Solid Supported Synthesis

Stains and Dyes

- Disperse Dyes

- Dye Intermediates

- Other Stains and Dyes

Heterocyclic Building Blocks

- Acridinium Series

- Benzimidazoles

- Benzisoxazoles

- Benzothiazoles

- Benzothiophenes

- Carbazole Series

- Imidazolidines

- Isoquinolines

- Naphthyridines

- Quinuclidines

- Tetrahydrofurans

- Tetrahydroisoquinolines

- Tetrahydropyrans

- Tetrahydroquinolines

- Thiazolidines

- Thiomorpholines

- Non-Halogenated Heterocycles

- Other Aromatic Heterocycles

- Other Aliphatic Heterocycles

- Aliphatic Heterocycles

- Aromatic Heterocycles

- Halogenated Heterocycles

Inorganic reagents

- Inorganic reagent

Boronic acids/esters

- 1,3-Propylene Glycol Ester

- 1,3,2-Dioxaborinane

- Aliphatic Borons

- Aromatic Borons

- MIDA Boronates

- Other Boronates

- Pinacol Boronates

- Potassium Organotrifluoroborate Salts

Bioactive Molecules

- Influenza Virus

- Orthopoxvirus

- Reverse Transcriptase

- Virus Protease

- Beta-lactamase

- Neuraminidase

- Penicillin-binding protein (PBP)

- Thymidylate Synthase

- Glutathione Peroxidase

- Heme Oxygenase

- Transferrin Receptor

Cell Cycle/DNA Damage

- Aurora Kinase

- Casein Kinase

- DNA Alkylator/Crosslinker

- DNA/RNA Synthesis

- Nucleoside Antimetabolite/Analog

- Poly(ADP-ribose) Glycohydrolase (PARG)

- Deubiquitinase

- Eukaryotic Initiation Factor (eIF)

- Checkpoint Kinase (Chk)

- Cyclin G-associated Kinase (GAK)

- Early 2 Factor (E2F)

- Haspin Kinase

- LIM Kinase (LIMK)

- Microtubule/Tubulin

- Arp2/3 Complex

- Gap Junction Protein

- Microtubule/Tubulin

- Aurora Kinase

- DNA Methyltransferase

- Epigenetic Reader Domain

- Glycosyltransferase

- Histone Acetyltransferase

- Histone Demethylase

- Histone Methyltransferase

- Methionine Adenosyltransferase (MAT)

- Protein Arginine Deiminase

- Small Interfering RNA (siRNA)

- Taste Receptor

- Amylin Receptor

- CGRP Receptor

- Glucagon Receptor

- PACAP Receptor

- Secretin Receptor

- Adenylate Cyclase

- G Protein-coupled Receptor Kinase (GRK)

- Guanylate Cyclase

- 5-HT Receptor

- Adenosine Receptor

- Adrenergic Receptor

- Angiotensin Receptor

- Apelin Receptor (APJ)

- Bombesin Receptor

- Bradykinin Receptor

- Cannabinoid Receptor

- Chemerin Receptor

- Cholecystokinin Receptor

- Dopamine Receptor

- Endothelin Receptor

- Formyl Peptide Receptor (FPR)

- Free Fatty Acid Receptor

- G protein-coupled Bile Acid Receptor 1

- GnRH Receptor

- Histamine Receptor

- Hydroxycarboxylic Acid Receptor (HCAR)

- Kisspeptin Receptor

- Leukotriene Receptor

- Mas-related G-protein-coupled Receptor (MRGPR)

- MCHR1 (GPR24)

- Melanocortin Receptor

- Melatonin Receptor

- Motilin Receptor

- Neurokinin Receptor

- Neuropeptide B/W Receptor

- Neuropeptide FF Receptor

- Neuropeptide Y Receptor

- Neurotensin Receptor

- Opioid Receptor

- Orexin Receptor (OX Receptor)

- Oxytocin Receptor

- Platelet-activating Factor Receptor (PAFR)

- Prostaglandin Receptor

- Protease Activated Receptor (PAR)

- RXFP Receptor

- Somatostatin Receptor

- Succinate Receptor 1

- Trace Amine-associated Receptor (TAAR)

- Urotensin Receptor

- Vasopressin Receptor

Immunology/Inflammation

- Aryl Hydrocarbon Receptor

- Complement System

- Cyclic GMP-AMP Synthase

- Glucocorticoid Receptor

- Glycoprotein VI

- Histamine Receptor

- Interleukin Related

- Macrophage migration inhibitory factor (MIF)

- NOD-like Receptor (NLR)

- Nuclear Factor of activated T Cells (NFAT)

- Reactive Oxygen Species

- Salt-inducible Kinase (SIK)

- Thrombopoietin Receptor

- Toll-like Receptor (TLR)

JAK/STAT Signaling

MAPK/ERK Pathway

- MAPKAPK2 (MK2)

- Mixed Lineage Kinase

- Ribosomal S6 Kinase (RSK)

Membrane Transporter/Ion Channel

- Calcium Channel

- Chloride Channel

- GABA Receptor

- Piezo Channel

- Potassium Channel

- Sodium Channel

- Apical Sodium-Dependent Bile Acid Transporter

- Monoamine Transporter

- Monocarboxylate Transporter

- Na+/Ca2+ Exchanger

- Na+/H+ Exchanger (NHE)

- Na+/HCO3- Cotransporter

- Na+/K+ ATPase

- P-glycoprotein

- Urea Transporter

- Mechanosensitive Channel

- Amino acid Transporter

Metabolic Enzyme/Protease

- Drug Metabolite

- Endogenous Metabolite

- Aminoacyl-tRNA Synthetase

- Dihydrofolate reductase (DHFR)

- Dihydroorotate Dehydrogenase

- HIV Integrase

- Methylenetetrahydrofolate Dehydrogenase (MTHFD)

- Phosphodiesterase (PDE)

- Acetolactate Synthase (ALS)

- Adenosine Deaminase

- Adenosine Kinase

- Aminopeptidase

- Angiotensin-converting Enzyme (ACE)

- Carboxypeptidase

- Dipeptidyl Peptidase

- Dopamine β-hydroxylase

- E1/E2/E3 Enzyme

- Enteropeptidase

- Farnesyl Transferase

- Glutathione Reductase

- Glutathione S-transferase

- Indoleamine 2,3-Dioxygenase (IDO)

- Methionine Adenosyltransferase (MAT)

- Mitochondrial Metabolism

- Carbohydrate Metabolism

- N-myristoyltransferase

- NADPH Oxidase

- NEDD8-activating Enzyme

- Procollagen C Proteinase

- Prolyl Endopeptidase (PREP)

- Reactive Oxygen Species

- Ser/Thr Protease

- Tryptophan Hydroxylase

- Xanthine Oxidase

- Aldose Reductase

- Carbonic Anhydrase

- Glutathione Peroxidase

- Glyoxalase (GLO)

- HIF/HIF Prolyl-Hydroxylase

- Ketohexokinase

- Lactate Dehydrogenase

- Mineralocorticoid Receptor

- Oxidative Phosphorylation

- Phosphoglycerate Dehydrogenase (PHGDH)

- Photosystem II

- Pyruvate Kinase

- Sialyltransferase

- Succinate Dehydrogenase

- Transketolase

- β-glucuronidase

- Hydroxysteroid Dehydrogenase(HSD)

- 5 alpha Reductase

- Acetyl-CoA Carboxylase

- Acyltransferase

- Adiponectin Receptor

- Aldehyde Dehydrogenase (ALDH)

- Apolipoprotein

- ATP Citrate Lyase

- Carboxylesterase

- Cytochrome P450

- Epoxide Hydrolase

- Fat Mass and Obesity-associated Protein (FTO)

- Fatty Acid Synthase (FASN)

- HMG-CoA Reductase (HMGCR)

- Isocitrate Dehydrogenase (IDH)

- Microsomal Triglyceride Transfer Protein (MTP)

- Phospholipase

- Stearoyl-CoA Desaturase (SCD)

- Steroid Sulfatase

- Glutamate Dehydrogenase (GLDH)

- Decarboxylase

- Phosphorylase

- 3C-Like Protease

- Protoporphyrinogen IX oxidase

Neuronal Signaling

- 5-HT Receptor

- Adenosine Kinase

- Adrenergic Receptor

- Beta-secretase

- Calcium Channel

- Cannabinoid Receptor

- CGRP Receptor

- Cholecystokinin Receptor

- Cholinesterase (ChE)

- Dopamine Receptor

- Dopamine Transporter

- GABA Receptor

- Glucosylceramide Synthase (GCS)

- Histamine Receptor

- Imidazoline Receptor

- MCHR1 (GPR24)

- Melanocortin Receptor

- Melatonin Receptor

- Monoamine Oxidase

- Neurokinin Receptor

- Neuropeptide Y Receptor

- Neurotensin Receptor

- Opioid Receptor

- Orexin Receptor (OX Receptor)

- Serotonin Transporter

- Sigma Receptor

- Somatostatin Receptor

- Transthyretin (TTR)

- Reactive Oxygen Species

- E3 Ligase Ligand-Linker Conjugates

- Ligands for E3 Ligase

- Ligands for Target Protein for PROTAC

- Molecular Glues

- PROTAC Linkers

- PROTAC-Linker Conjugates for PAC

- Target Protein Ligand-Linker Conjugates

Protein Tyrosine Kinase/RTK

- Anaplastic lymphoma kinase (ALK)

- Discoidin Domain Receptor

- Ephrin Receptor

- GDNF Receptor

- Insulin Receptor

- Casein Kinase

- TGF-beta/Smad

- Wnt/beta-catenin

- Stemness kinase

- TGF-beta/Smad

- TGF-β Receptor

Vitamin D Related/Nuclear Receptor

- Androgen Receptor

- Constitutive Androstane Receptor

- Estrogen Receptor/ERR

- Estrogen/progestogen Receptor

- Glucocorticoid Receptor

- Mineralocorticoid Receptor

- Nuclear Hormone Receptor 4A/NR4A

- Progesterone Receptor

- Thyroid Hormone Receptor

- Amino Acid Derivatives

- Biochemical Assay Reagents

- Fluorescent Dye

- Isotope-Labeled Compounds

- Hydrotropic Agents

Screening Libraries

Focused and targeted libraries

Active Reference Sets

Diversity libraries

Preplated libraries

Inhibitors and Approved Drugs

Natural Products Series

- Natural Product Screening Libraries

- Classification by Natural Products Structures

- Traditional Chinese Medicine Related Libraries

Bioactive Compound Series

- Bioactive Screening Libraries

- Metabolism Series

- Drug Repurposing Series

- Disease Related Compound Libraries

- According to Signaling Pathway or Protein Family

- According to Product Features

- According to Structures

Diversity Compound Libraries

- Distinctive Diversity Libraries

- Focused and target libraries

- According to Lead-like Structures

Fragment Libraries

- Functional Fragment Libraries

- According to Fragment Structures

- Featured Fragment Libraries

Natural Products

Phenylpropanoids

Sesquiterpenoids

Tetraterpenoids

Stibene glucosides

Botanical Cyclopeptides

Pharma Intermediates

Material Science

- Carbon nanostructure unit

Electronic Materials

- Electronic Material

- Liquid Crystal (LC) Materials

- Organic Light Emitting Diode (OLED)

- Molecular Self-Assembly

- Molecular Conductor

- Flexible Printed Electronics

- Polyimide Monomer

- Photoresist Monomer

- Deuterated optoelectronic materials

- Self assembly and contact printing materials

- Org. Field- Effect Transistor

Optical Materials

- Fluorescence Materials

- Phthalocyanine Dye

- Heat Sensitive Dye

- Quinacridone Dye

- Dipyrrole Methylene Dye

- Photochromic Dye

- Other Functional Dyes

Material Composite Block

- Optoelectronic Material Intermediate

- Small Molecule Semiconductor Synthesis Building Block

- Semiconducting Polymer Synthetic Building Block

- Derivatization Reagents To Improve Solubility

- Supramolecular Host Material

- Functional Metal Complex Ligand

- Phthalocyanine Building Block

- Liquid Crystal (LC) Block

Solar Cell Materials

- Perovskite Solar Cell ( PSC) Materials

- Organic Solar Cell (OPV) Materials

- Dye Sensitized Solar Cell (DSSC) Materials

- Other Solar cell materials

- Donor Intermediate DI

- Receptor Intermediate AI

- Organic Photovoltaic OPV

Organic Pigments

- Organic Pigments

Covalent Organic Frameworks

- Amido COFs Linkers

- Aldehyde COFs Linkers

- Alkyne COFs Linkers

- Hydroxyl COFs Linkers

- Boric Acid COFs Linkers

- Nitrile COFs Linkers

- Halogenated COFs Linkers

- Nitro COFs Linkers

- COF organic frame single block

- Other COFs Linkers

- COF-covalent organic framework material

Metal Organic Frameworks

- Hybrid MOFs Linkers

- Nitrogen MOFs Linkers

- Carboxylic MOFs Linkers

- Hydroxy MOFs Linkers

- Phosphate MOFs Linkers

- MOF organic framework ligand block

- MOF Finished Products

- Sulfonic Acid MOFs Linkers

- Ionic MOFs Linkers

- Other MOFs Linkers

- Halogen-containing MOF ligand

- Two-dimensional MOF ligand

Aggregation-Induced Emission

- Aggregation Induced Emission (AIE) materials

- Electron Transport Materials

- Other OLED related materials

Polymer Materials

- Macromolecular Monomer

- Other Polymer Materials

- Dendrimer Building Block

- Polymer Additives

- Polymerization Functional Reagents

- Polyimide Raw Materials

Organic Electrosynthesis

- Quaternary ammonium salt

- Pyridine salt

Organic-Inorganic Hybrid Materials

- Organic-inorganic perovskite precursor

- A silane coupling agent

- Organometallic compound

- ADC Cytotoxin

- Calicheamicins

- Daunorubicins/Doxorubicins

- Maytansinoids

- Pyrrolobenzodiazepines

- Traditional Cytotoxic Agents

- Cleavable Linker

- Non-cleavable Linker

- Acid Cleavable Linker

- Disulfide Cleavable Linker

- Protease Cleavable Linker

- Glycosidase Cleavable Linker

- Phosphatase Cleavable Linker

Antibody-Drug Conjugates (ADCs)

Drug-Linker Conjugates for ADC

- Drug-Linker Conjugates for ADC

- Camptothecins

- Daunorubicins/Doxorubicins

- Maytansinoids

- Pyrrolobenzodiazepines

- Traditional Cytotoxic Agents

- Dual payloads

Peptide-Drug Conjugates (PDCs)

PROTAC Components

- PROTAC-Linker Conjugates for PAC

Radionuclide-Drug Conjugates (RDCs)

- Radionuclide-Drug Conjugates (RDCs)

- RDC Bifunctional Chelator

Monodispersed PEGs

- Methoxy PEG (mPEG)

- Azide(N3) PEG

- Amine(NH2) PEG

- Hydroxyl(OH) PEG

- Thiol(SH) PEG

- Carboxylic Acid(COOH) PEG

- Maleimide(Mal) PEG

- NHS ester PEG

- Aldehyde (Ald/CHO)PEG

- Acrylate(AC) PEG

- Acrylamide(ACA) PEG

- Other Lipid PEG

- Fluorescent (FITC) PEG

- Rhodamine B(RB) PEG

- Cholesterol PEG

- Epoxide (EPO) PEG

- Hydrazide (HZ) PEG

- Folic Acid(FA) PEG

- Lipoic acid(LA) PEG

- Methacrylate (MA) PEG

- PEG Sulfonic acid

- PEG PFP ester

- PEG TFP ester

- Halide (F,Cl,Br,I) PEG

- Hydrocarbons PEG

- Nitrophenyl Carbonate (NPC) PEG

- PROTAC Linker

Polydispersed PEGs

- Methoxy PEG (mPEG)

- Azide(N3) PEG

- Amine(NH2) PEG

- Hydroxyl(OH) PEG

- Thiol(SH) PEG

- Carboxylic Acid(COOH) PEG

- Maleimide(Mal) PEG

- NHS ester PEG

- Other Lipid PEG

- Acrylate(AC) PEG

- Aldehyde (Ald/CHO)PEG

- Fluorescent (FITC) PEG

- Cyanine (Cy) PEG

- Rhodamine B(RB) PEG

- Cholesterol PEG

- Acrylamide(ACA) PEG

- Epoxide (EPO) PEG

- Hydrazide (HZ) PEG

- Folic Acid(FA) PEG

- Lipoic acid(LA) PEG

- Methacrylate (MA) PEG

- PEG Sulfonic acid

- PEG PFP ester

- Halide (F,Cl,Br,I) PEG

- Hydrocarbons PEG

- Nitrophenyl Carbonate (NPC) PEG

- Hydroxyl(OH) PEG

- NHS ester PEG

- Amine(NH2) PEG

- Maleimide(Mal) PEG

- Azide(N3) PEG

- Thiol(SH) PEG

- Carboxylic Acid(COOH) PEG

- Aldehyde (Ald/CHO)PEG

- Methoxy PEG (mPEG)

- Acrylate(AC) PEG

- Cholesterol PEG

- Acrylamide(ACA) PEG

- Epoxide (EPO) PEG

- Hydrazide (HZ) PEG

- Folic Acid(FA) PEG

- Lipoic acid(LA) PEG

- Methacrylate (MA) PEG

- Halide (F,Cl,Br,I) PEG

- Hydrocarbons PEG

- Nitrophenyl Carbonate (NPC) PEG

PEGs by Application

- PROTAC Linkers

- Drug Delivery

- 3D Bioprinting

- Click Chemistry

Lipids for Lipid Nanoparticles

PEG Raw Material

Primary Antibodies

Secondary Antibodies

- Cell Culture Dishes

- Cell Culture Flasks

- Culture Tubes

- Multiwell Plate Systems

- Cell Strainers

- Culture Supports

Liquid Handling

- Pipette Tip Systems

- Transfer Pipets

- Reagent Reservoirs

- Centrifuge Tubes

- Round Bottom Tubes

- Culture System Connectors

- Liquid Handling Accessories

Filtration Systems

- Filtration Equipment

- Filtration Consumables

Storage Containers

- Cryogenic Storage Systems

- Reagent Storage Bottles

- General Sample Containers

Media & Sera & Reagents

- Specialty Media

- 3D Clearing Reagents

- Laboratory Water

- Inoculation Tools

- Cell Spreaders

- Homogenization Bags

- Deep Well Plates

Glassware / Plasticware

- Erlenmeyer Flasks

- Graduated Cylinders

- Low Actinic Ware

General Labware

- Support Clamps

Specialty Products

- Microscope Slides

- Molecular Equipment

- Automation Consumables

- Distillation & Reflux Systems

- Agitation Equipment

Custom Synthesis

Rare Earth Metal Compounds

Transition Metal Compounds

Chiral Compound

Chiral Reagents/Auxiliary

Lithium Reagent

Grignard Reagents

Silylating Reagents

Organosilicon Compounds

Inorganic Salts

Inorganic Compounds

Coupling Reagent

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

HY-P3431

2279952-25-7

MCE

Unifiram

HY-125931

272786-64-8

$27.0 / 10 mM * 1 mL in DMSO

MCE

(S)-Alaproclate

(S)-Alaproclate

HY-124779

66171-75-3

MCE

Flupirtine

HY-17001A

56995-20-1

$55.0 / 10 mM * 1 mL in DMSO

MCE

Ro 25-6981

HY-13993

169274-78-6

$105.0 / 10 mM * 1 mL in DMSO

MCE

Felbamate hydrate

Felbamate hydrate

HY-B0184A

1177501-39-1

MCE

PEAQX

HY-12294

459836-30-7

MCE

(S)-(-)-5-Fluorowillardiine

(S)-(-)-5-Fluorowillardiine

HY-16713

140187-23-1

$112.0 / 5mg

MCE

Rapastinel

HY-16728

117928-94-6

$104.0 / 10 mM * 1 mL in DMSO

MCE

Orphenadrine hydrochloride

Orphenadrine hydrochloride

HY-B1126

341-69-5

MCE

Tat-NR2B9c

HY-P0117

500992-11-0

$84.0 / 1mg

MCE

GV-196771A

HY-19243

166974-23-8

$1347.0 / 1mg

MCE

CNS-5161 hydrochloride

CNS-5161 hydrochloride

HY-101809

160756-38-7

$1344.0 / 1mg

MCE

Becampanel

HY-15073

188696-80-2

MCE

RPR104632

HY-101600

154106-92-0

$1347.0 / 1mg

MCE

UK-240455

HY-19391

178908-09-3

$571.0 / 1mg

MCE

NT 13

HY-P7060

117928-93-5

MCE

GNE 5729

HY-107409

2026635-66-3

$780.0 / 5mg

MCE

GNE-0723

HY-108337

1883518-31-7

$440.0 / 1mg

MCE

PF-4778574

HY-14451

1219633-99-4

MCE

Powered by Arctom Copyright © 2026 Arctom. All rights reserved.